PDB entry 1fpy

View 1fpy on RCSB PDB site
Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin
Deposited on 2000-08-31, released 2001-04-04
The last revision prior to the SCOP 1.63 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.248
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyA (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyB (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyC (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyD (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyE (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyF (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyG (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyH (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyI (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyJ (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyK (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpyL (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv