PDB entry 1fpw

View 1fpw on RCSB PDB site
Description: structure of yeast frequenin
Class: metal binding protein
Keywords: EF-hand, calcium, METAL BINDING PROTEIN
Deposited on 2000-08-31, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-binding protein ncs-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fpwa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fpwA (A:)
mgaktsklskddltclkqstyfdrreiqqwhkgflrdcpsgqlaredfvkiykqffpfgs
pedfanhlftvfdkdnngfihfeefitvlsttsrgtleeklswafelydlnhdgyitfde
mltivasvykmmgsmvtlnedeatpemrvkkifklmdknedgyitldefregskvdpsii
galnlydgli