PDB entry 1fpu

View 1fpu on RCSB PDB site
Description: crystal structure of abl kinase domain in complex with a small molecule inhibitor
Class: transferase
Keywords: kinase, kinase inhibitor, STI-571, activation loop
Deposited on 2000-08-31, released 2000-09-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proto-oncogene tyrosine-protein kinase abl
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • cloning artifact (2-5)
    Domains in SCOP 1.73: d1fpua_
  • Chain 'B':
    Compound: proto-oncogene tyrosine-protein kinase abl
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (6-End)
      • cloning artifact (2-5)
    Domains in SCOP 1.73: d1fpub_
  • Heterogens: PRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fpuA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpuA (A:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fpuB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpuB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrtytahagakfpikwtape
    slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
    elmracwqwnpsdrpsfaeihqafetmfqe