PDB entry 1fpu

View 1fpu on RCSB PDB site
Description:
Deposited on 2000-08-31, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fpua_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fpub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpuA (A:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fpuB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
    wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
    pekvyelmracwqwnpsdrpsfaeihqafetmfqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpuB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
    keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
    tqissameylekknfihrdlaarnclvgenhlvkvadfglsrtytahagakfpikwtape
    slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
    elmracwqwnpsdrpsfaeihqafetmfqe