PDB entry 1fps

View 1fps on RCSB PDB site
Description: crystal structure of recombinant farnesyl diphosphate synthase at 2.6 angstroms resolution
Class: prenyltransferase
Keywords: prenyltransferase
Deposited on 1994-06-30, released 1995-07-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1fpsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpsA (A:)
    spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
    aayrelsgpgqkdaeslrcalavgwcielfqafflvaddimdqsltrrgqlcwykkegvg
    ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
    shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
    ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
    eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk