PDB entry 1fps

View 1fps on RCSB PDB site
Description: crystal structure of recombinant farnesyl diphosphate synthase at 2.6 angstroms resolution
Deposited on 1994-06-30, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1fps__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fps_ (-)
    spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
    aayrelsgpgqkdaeslrcalavgwcielfqafflvaddimdqsltrrgqlcwykkegvg
    ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
    shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
    ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
    eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk