PDB entry 1fpr

View 1fpr on RCSB PDB site
Description: crystal structure of the complex formed between the catalytic domain of shp-1 and an in vitro peptide substrate py469 derived from shps-1.
Deposited on 2000-08-31, released 2001-03-07
The last revision prior to the SCOP 1.69 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1fpra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fprA (A:)
    gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
    nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
    pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
    psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
    diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevl