PDB entry 1fpq

View 1fpq on RCSB PDB site
Description: crystal structure analysis of selenomethionine substituted chalcone o-methyltransferase
Class: transferase
Keywords: selenomethionine substituted protein, TRANSFERASE
Deposited on 2000-08-31, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.247
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoliquiritigenin 2'-o-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93324 (Start-371)
      • modified residue (28)
      • modified residue (62)
      • modified residue (87)
      • modified residue (117)
      • modified residue (148)
      • modified residue (180)
      • modified residue (188)
      • modified residue (196)
      • modified residue (199)
      • modified residue (260)
      • modified residue (270)
      • modified residue (328)
      • modified residue (367)
    Domains in SCOPe 2.07: d1fpqa1, d1fpqa2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fpqA (A:)
    mgnsyitkednqisatseqtedsaclsamvlttnlvypavlnaaidlnlfeiiakatppg
    afmspseiasklpastqhsdlpnrldrmlrllasysvltsttrtiedggaervyglsmvg
    kylvpdesrgylasfttflcypallqvwmnfkeavvdedidlfknvhgvtkyefmgkdkk
    mnqifnksmvdvcatemkrmleiytgfegistlvdvgggsgrnleliiskyplikginfd
    lpqvienapplsgiehvggdmfasvpqgdamilkavchnwsdekcieflsnchkalspng
    kviivefilpeepntseesklvstldnlmfitvggrertekqyeklsklsgfskfqvacr
    afnslgvmefyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpqA (A:)
    tedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqhs
    dlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdesrgylasfttfl
    cypallqvwmnfkeavvdedkmnqifnksmvdvcatemkrmleiytgfegistlvdvggg
    sgrnleliiskyplikginfdlpqvienapplsgiehvggdmfasvpqgdamilkavchn
    wsdekcieflsnchkalspngkviivefilpeepntseesklvstldnlmfitvggrert
    ekqyeklsklsgfskfqvacrafnslgvmefyk