PDB entry 1fpp

View 1fpp on RCSB PDB site
Description: protein farnesyltransferase complex with farnesyl diphosphate
Class: prenyltransferase
Keywords: prenyltransferase, membrane localization, heterodimer, zinc
Deposited on 1998-07-10, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.24
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase
    Species: Rattus norvegicus, synthetic [TaxId:10116]
    Gene: FNTA, FNTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fppa_
  • Chain 'B':
    Compound: protein farnesyltransferase
    Species: Rattus norvegicus, synthetic [TaxId:10116]
    Gene: FNTA, FNTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fppb_
  • Heterogens: ZN, PO4, FPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fppA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fppA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhsre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fppB (B:)
    massssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpv
    pgfeecedavtsdpatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fppB (B:)
    plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
    lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
    ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
    rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
    lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
    alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
    lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvp