PDB entry 1fpf

View 1fpf on RCSB PDB site
Description: structural aspects of the allosteric inhibition of fructose-1,6-bisphosphatase by amp: the binding of both the substrate analogue 2,5-anhydro-d-glucitol-1,6-bisphosphate and catalytic metal ions monitored by x-ray crystallography
Class: hydrolase (phosphoric monoester)
Keywords: hydrolase (phosphoric monoester)
Deposited on 1994-12-15, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose 1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00636 (Start-334)
      • conflict (19)
      • conflict (95)
      • conflict (198)
    Domains in SCOPe 2.08: d1fpfa_
  • Chain 'B':
    Compound: fructose 1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00636 (Start-334)
      • conflict (19)
      • conflict (95)
      • conflict (198)
    Domains in SCOPe 2.08: d1fpfb_
  • Heterogens: MN, AHG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fpfA (A:)
    tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpfA (A:)
    nivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygiagkldvlsn
    dlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpldgssnidclvsigtifgi
    yrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpaigefilvdr
    nvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmvadvhrtlvy
    ggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdihqrapiil
    gspedvtelleiyqkha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fpfB (B:)
    tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpfB (B:)
    nivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygiagkldvlsn
    dlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpldgssnidclvsigtifgi
    yrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpaigefilvdr
    nvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmvadvhrtlvy
    ggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptdihqrapiil
    gspedvtelleiyqkha