PDB entry 1fp0

View 1fp0 on RCSB PDB site
Description: solution structure of the phd domain from the kap-1 corepressor
Deposited on 2000-08-29, released 2001-01-24
The last revision prior to the SCOP 1.71 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1fp0a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fp0A (A:)
  mrgshhhhhhgsdiidefgtlddsaticrvcqkpgdlvmcnqcefcfhldchlpalqdvp
  geewscslchvlpdlkeedvdlqackln