PDB entry 1fox

View 1fox on RCSB PDB site
Description: nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, 33 structures
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding domain, l11-c76, alpha-helical protein, homeodomain fold
Deposited on 1996-09-13, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l11-c76
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1foxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1foxA (A:)
    mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivved