PDB entry 1fow

View 1fow on RCSB PDB site
Description: nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, minimized average structure
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding domain, l11-c76, alpha-helical protein, homeodomain fold
Deposited on 1996-09-13, released 1997-03-12
The last revision prior to the SCOP 1.75 freeze date was dated 1997-03-12, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l11-c76
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fowa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fowA (A:)
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved