PDB entry 1fov

View 1fov on RCSB PDB site
Description: glutaredoxin 3 from escherichia coli in the fully oxidized form
Class: electron transport
Keywords: Active site disulfide, cis Pro 53, ELECTRON TRANSPORT
Deposited on 2000-08-29, released 2000-10-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin 3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AC62 (0-81)
      • conflict (64)
    Domains in SCOPe 2.04: d1fova_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fovA (A:)
    anveiytketcpychrakallsskgvsfqelpidgnaakreemikrsgrttvpqifidaq
    higgyddlyaldarggldpllk