PDB entry 1for

View 1for on RCSB PDB site
Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-05-24, released 1994-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.174
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 17-ia fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (0-218)
      • conflict (1)
      • conflict (8)
      • conflict (15)
      • conflict (27)
      • conflict (29-34)
      • conflict (42)
      • conflict (49)
      • conflict (54)
      • conflict (56-57)
      • conflict (61)
      • conflict (71)
      • conflict (73)
      • conflict (76)
      • conflict (83)
      • conflict (98)
      • insertion (100-101)
      • conflict (102-103)
      • conflict (135)
      • conflict (178)
      • conflict (197)
    Domains in SCOPe 2.06: d1forh1, d1forh2
  • Chain 'L':
    Compound: igg2a-kappa 17-ia fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA56279 (0-209)
      • conflict (13-14)
      • conflict (17)
      • conflict (20)
      • conflict (23)
      • conflict (25)
      • conflict (29)
      • conflict (31)
      • conflict (34)
      • conflict (40)
      • conflict (49)
      • conflict (75)
      • conflict (87)
      • conflict (89-92)
      • conflict (94)
      • conflict (98)
    Domains in SCOPe 2.06: d1forl1, d1forl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1forH (H:)
    qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
    ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvssa
    kttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsgl
    ytlsssvtvtsstwpsqtitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1forL (L:)
    qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr