PDB entry 1for

View 1for on RCSB PDB site
Description:
Deposited on 1994-05-24, released 1994-09-30
The last revision prior to the SCOP 1.65 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 2.75 Å
R-factor: 0.174
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1forh1, d1forh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1forl1, d1forl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1forH (H:)
    qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
    ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvssa
    kttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsgl
    ytlsssvtvtsstwpsqtitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1forL (L:)
    qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr