PDB entry 1fon

View 1fon on RCSB PDB site
Description: crystal structure of bovine procarboxypeptidase a-s6 subunit III, a highly structured truncated zymogen e
Class: serine protease
Keywords: truncated zymogen e, serine protease
Deposited on 1996-02-01, released 1996-10-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procarboxypeptidase a-s6
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05805 (Start-239)
      • conflict (151)
    Domains in SCOPe 2.01: d1fona_
  • Chain 'B':
    Compound: procarboxypeptidase a-s6
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05805 (Start-239)
      • conflict (151)
    Domains in SCOPe 2.01: d1fonb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fonA (A:)
    ngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyqvvlgeydr
    svlegseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqlanlppagdi
    lpneapcyisgwgrlytggplpdklqqallptvdyehcsqwdwwgitvkktmvcaggdtr
    sgcngdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidwidetiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fonA (A:)
    swswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyqvvlgeydrsvlegseq
    vipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqlanlppagdilpneapcy
    isgwgrlytggplpdklqqallptvdyehcsqwdwwgitvkktmvcaggdtrsgcngdsg
    gplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidwidetiasn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fonB (B:)
    ngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyqvvlgeydr
    svlegseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqlanlppagdi
    lpneapcyisgwgrlytggplpdklqqallptvdyehcsqwdwwgitvkktmvcaggdtr
    sgcngdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidwidetiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fonB (B:)
    swswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyqvvlgeydrsvlegseq
    vipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqlanlppagdilpneapcy
    isgwgrlytggplpdklqqallptvdyehcsqwdwwgitvkktmvcaggdtrsgcngdsg
    gplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidwidetiasn