PDB entry 1foh

View 1foh on RCSB PDB site
Description: phenol hydroxylase from trichosporon cutaneum
Class: flavin
Keywords: flavin, phenol hydroxylase, monooxygenase, oxidoreductase
Deposited on 1998-03-26, released 1998-06-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenol hydroxylase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245 (0-End)
      • conflict (264)
    Domains in SCOPe 2.05: d1foha3, d1foha4, d1foha5
  • Chain 'B':
    Compound: phenol hydroxylase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245 (0-663)
      • conflict (264)
    Domains in SCOPe 2.05: d1fohb3, d1fohb4, d1fohb5
  • Chain 'C':
    Compound: phenol hydroxylase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245 (0-663)
      • conflict (264)
    Domains in SCOPe 2.05: d1fohc3, d1fohc4, d1fohc5
  • Chain 'D':
    Compound: phenol hydroxylase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245 (0-End)
      • conflict (264)
    Domains in SCOPe 2.05: d1fohd3, d1fohd4, d1fohd5
  • Heterogens: FAD, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fohA (A:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
    rvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdach
    thspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsr
    lfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvv
    gtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsens
    vislytpkvsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphp
    ksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwt
    ksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fohA (A:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqftpevvi
    anakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspkagqgmnts
    mmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsrlfsgrpakdvade
    mgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfksqpvvrhs
    eglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsensvislytpkvsdrn
    sridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqawgvdetkg
    avvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fohB (B:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
    rvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdach
    thspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsr
    lfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvv
    gtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsens
    vislytpkvsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphp
    ksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwt
    ksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fohB (B:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqftpevvi
    anakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspkagqgmnts
    mmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsrlfsgrpakdvade
    mgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfksqpvvrhs
    eglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsensvislytpkvsdrn
    sridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqawgvdetkg
    avvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtksta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fohC (C:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
    rvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdach
    thspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsr
    lfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvv
    gtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsens
    vislytpkvsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphp
    ksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwt
    ksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fohC (C:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlrvdrtkft
    pevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspkagq
    gmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsrlfsgrpak
    dvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfksqp
    vvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsensvislytpk
    vsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqawgv
    detkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtksta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fohD (D:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
    rvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdach
    thspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsr
    lfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvv
    gtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsens
    vislytpkvsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphp
    ksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwt
    ksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fohD (D:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
    hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqvdrtkft
    pevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspkagq
    gmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsrlfsgrpak
    dvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfksqp
    vvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsensvislytpk
    vsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqawgv
    detkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtks