PDB entry 1foa

View 1foa on RCSB PDB site
Description: crystal structure of n-acetylglucosaminyltransferase i
Deposited on 2000-08-26, released 2001-05-16
The last revision prior to the SCOP 1.67 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1foaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1foaA (A:)
    srlqelavipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygs
    avthirqpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapd
    ffeyfqatypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwa
    elepkwpkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqq
    fvpftqldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkaf
    akalgvmddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1foaA (A:)
    avipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthir
    qpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyfq
    atypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepkw
    pkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqqfvpftq
    ldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgv
    mddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt