PDB entry 1fo8

View 1fo8 on RCSB PDB site
Description: crystal structure of n-acetylglucosaminyltransferase i
Deposited on 2000-08-26, released 2001-04-25
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fo8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo8A (A:)
    lavipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthi
    rqpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyf
    qatypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepk
    wpkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqqfvpft
    qldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalg
    vmddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo8A (A:)
    lavipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthi
    rqpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyf
    qatypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepk
    wpkafwddwmrrpeqrkgracvrpeisrtmtfglkfiklnqqfvpftqldlsylqqeayd
    rdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgvmddlksgvprag
    yrgivtflfrgrrvhlappqtwdgydpswt