PDB entry 1fo0

View 1fo0 on RCSB PDB site
Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Deposited on 2000-08-24, released 2000-10-02
The last revision prior to the SCOP 1.71 freeze date was dated 2000-10-02, with a file datestamp of 2000-10-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo0A (A:)
    qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
    ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo0A (A:)
    kvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatvg
    hyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrliv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0H (H:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm