PDB entry 1fnz

View 1fnz on RCSB PDB site
Description: a bark lectin from robinia pseudoacacia in complex with n-acetylgalactosamine.
Class: sugar binding protein
Keywords: jelly roll
Deposited on 2000-08-24, released 2001-08-24
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bark agglutinin I, polypeptide a
    Species: Robinia pseudoacacia
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41159 (0-236)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (43)
      • see remark 999 (73)
      • see remark 999 (82)
      • see remark 999 (102)
      • see remark 999 (131-133)
      • see remark 999 (140)
      • see remark 999 (148)
      • see remark 999 (191-192)
      • see remark 999 (199)
    Domains in SCOP 1.73: d1fnza_
  • Heterogens: A2G, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fnzA (A:)
    tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
    sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkdgyfnksnq
    ivavefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltas
    lvypsletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnzA (A:)
    tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
    sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkfnksnqiva
    vefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltaslvy
    psletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg