PDB entry 1fnz

View 1fnz on RCSB PDB site
Description: A bark lectin from robinia pseudoacacia in complex with N-acetylgalactosamine
Deposited on 2000-08-24, released 2001-08-24
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-24, with a file datestamp of 2001-08-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fnza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fnzA (A:)
    tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
    sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkdgyfnksnq
    ivavefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltas
    lvypsletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnzA (A:)
    tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
    sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkfnksnqiva
    vefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltaslvy
    psletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg