PDB entry 1fny

View 1fny on RCSB PDB site
Description: legume lectin of the bark of robinia pseudoacacia.
Deposited on 2000-08-24, released 2001-08-24
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-24, with a file datestamp of 2001-08-24.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fnya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fnyA (A:)
    tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
    sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkdgyfnksnq
    ivavefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltas
    lvypsletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnyA (A:)
    tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
    sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkfnksnqiva
    vefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltaslvy
    psletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg