PDB entry 1fnx

View 1fnx on RCSB PDB site
Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element
Class: immune system/RNA
Keywords: RNA-binding domain, protein-RNA complex, immune system/RNA COMPLEX
Deposited on 2000-08-24, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: hu antigen c
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60900 (0-173)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1fnxh1, d1fnxh2, d1fnxh3
  • Chain 'R':
    Compound: au-rich RNA element

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnxH (H:)
    mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndad
    kaintlnglklqtktikvsyarpssasirdanlyvsglpktmsqkemeqlfsqygriits
    rilldqatgvsrgvgfirfdkrieaeeaikglngqkplgaaepitvkfannpsq
    

  • Chain 'R':
    No sequence available.