PDB entry 1fnx

View 1fnx on RCSB PDB site
Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element
Deposited on 2000-08-24, released 2003-06-24
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnxH (H:)
    mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndad
    kaintlnglklqtktikvsyarpssasirdanlyvsglpktmsqkemeqlfsqygriits
    rilldqatgvsrgvgfirfdkrieaeeaikglngqkplgaaepitvkfannpsq