PDB entry 1fnw

View 1fnw on RCSB PDB site
Description: crystal structure of streptococcal pyrogenic exotoxin a
Deposited on 2000-08-23, released 2000-11-17
The last revision prior to the SCOP 1.63 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: 0.213
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwA (A:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwC (C:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwE (E:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwF (F:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwG (G:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnwH (H:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk