PDB entry 1fns

View 1fns on RCSB PDB site
Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
Class: immune system
Keywords: von willebrand factor, glycoprotein iba (a:alpha) binding, complex (willebrand-immunoglobulin), blood coagulation type 2b von willebrand disease, immune system
Deposited on 2000-08-23, released 2000-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275 (1-195)
      • cloning artifact (0)
      • conflict (39)
    Domains in SCOPe 2.06: d1fnsa1, d1fnsa2
  • Chain 'H':
    Compound: immunoglobulin nmc-4 igg1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FNS (0-224)
    Domains in SCOPe 2.06: d1fnsh1, d1fnsh2
  • Chain 'L':
    Compound: immunoglobulin nmc-4 igg1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FNS (0-213)
    Domains in SCOPe 2.06: d1fnsl1, d1fnsl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnsA (A:)
    mycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdgshayi
    glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
    pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
    rdeivsylcdlapeap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fnsH (H:)
    qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnsH (H:)
    qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnsL (L:)
    diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec