PDB entry 1fns

View 1fns on RCSB PDB site
Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
Deposited on 2000-08-23, released 2000-10-18
The last revision prior to the SCOP 1.69 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnsA (A:)
    mycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdgshayi
    glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
    pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
    rdeivsylcdlapeap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fnsH (H:)
    qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnsH (H:)
    qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnsL (L:)
    diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec