PDB entry 1fnn

View 1fnn on RCSB PDB site
Description: crystal structure of cdc6p from pyrobaculum aerophilum
Class: cell cycle
Keywords: cdc6, cdc18, orc1, AAA protein, DNA replication initation factor, cell cycle control factor
Deposited on 2000-08-22, released 2000-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division control protein 6
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fnna1, d1fnna2
  • Chain 'B':
    Compound: cell division control protein 6
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fnnb1, d1fnnb2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fnnA (A:)
    maivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvt
    lrklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehl
    rerdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstr
    gimgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgda
    rlaidilyrsayaaqqngrkhiapedvrksskevlfgiseevliglplheklfllaivrs
    lkishtpyitfgdaeesykivceeygerprvhsqlwsylndlrekgivetrqnkrgegvr
    grttlisigtepldtleavitklikeelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnnA (A:)
    aivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvtl
    rklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehlr
    erdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstrg
    imgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgdar
    laidilyrsayaaqqngrkhiapedvrksskevlfgiseevliglplheklfllaivrsl
    kishtpyitfgdaeesykivceeygerprvhsqlwsylndlrekgivetrqnttlisigt
    epldtleavitklikeelr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fnnB (B:)
    maivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvt
    lrklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehl
    rerdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstr
    gimgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgda
    rlaidilyrsayaaqqngrkhiapedvrksskevlfgiseevliglplheklfllaivrs
    lkishtpyitfgdaeesykivceeygerprvhsqlwsylndlrekgivetrqnkrgegvr
    grttlisigtepldtleavitklikeelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fnnB (B:)
    aivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvtl
    rklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehlr
    erdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstrg
    imgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgdar
    laidilyrsayaaqqngrkhiapedvrksskevlfgiseevliglplheklfllaivrsl
    kishtpyitfgdaeesykivceeygerprvhsqlwsylndlrekgivetrqnttlisigt
    epldtleavitklikeelr