PDB entry 1fnj

View 1fnj on RCSB PDB site
Description: crystal structure analysis of chorismate mutase mutant c88s/r90k
Class: isomerase
Keywords: chorismate mutase, protein, mutant, pseudo-alpha beta-barrel, trimer, ISOMERASE
Deposited on 2000-08-22, released 2000-10-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chorismate mutase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19080
      • modified residue (74)
      • engineered (87)
      • engineered (89)
    Domains in SCOPe 2.05: d1fnja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fnjA (A:)
mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
avrelsgwqyvpvtcmqemdvtgglkksikvmmtvqtdvpqdqirhvylekavvlrpdls
ltkntel

    Sequence, based on observed residues (ATOM records): (download) 
    >1fnjA (A:)
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkksikvmmtvqtdvpqdqirhvylekavvlr