PDB entry 1fne

View 1fne on RCSB PDB site
Description: histocompatibility antigen
Deposited on 2000-08-21, released 2001-03-07
The last revision prior to the SCOP 1.63 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fneA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fneB (B:)
    kkvitafndglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fneC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fneD (D:)
    kkvitafndglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew