PDB entry 1fn6

View 1fn6 on RCSB PDB site
Description: crystal structure of porcine beta trypsin with 0.1% polydocanol
Class: hydrolase
Keywords: serine protease, hydrolase
Deposited on 2000-08-21, released 2000-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • see remark 999 (144)
      • see remark 999 (166)
    Domains in SCOPe 2.08: d1fn6a_
  • Heterogens: CA, SO4, EDO, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn6A (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan