PDB entry 1fn5

View 1fn5 on RCSB PDB site
Description: hen egg white lysozyme mutant with alanine substituted for glycine
Class: hydrolase
Keywords: hen lysozyme, alanine scanning
Deposited on 2000-08-21, released 2000-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.172
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (48)
    Domains in SCOP 1.75: d1fn5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn5A (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdastdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl