PDB entry 1fn4

View 1fn4 on RCSB PDB site
Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
Class: immune system
Keywords: fab198, immune system
Deposited on 2000-08-21, released 2001-09-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody against acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FN4 (0-210)
    Domains in SCOPe 2.03: d1fn4a1, d1fn4a2
  • Chain 'B':
    Compound: monoclonal antibody against acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FN4 (0-217)
    Domains in SCOPe 2.03: d1fn4b1, d1fn4b2
  • Chain 'C':
    Compound: monoclonal antibody against acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FN4 (0-210)
    Domains in SCOPe 2.03: d1fn4c1, d1fn4c2
  • Chain 'D':
    Compound: monoclonal antibody against acetylcholine receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FN4 (0-217)
    Domains in SCOPe 2.03: d1fn4d1, d1fn4d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4A (A:)
    dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
    rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkrtaptvsifppste
    qlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsltk
    adyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4B (B:)
    qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
    salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
    vssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsglytl
    tssvtvpsstwssqavtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4C (C:)
    dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
    rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkrtaptvsifppste
    qlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsltk
    adyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4D (D:)
    qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
    salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
    vssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsglytl
    tssvtvpsstwssqavtcnvahpasstkvdkkivprdc