PDB entry 1fn4

View 1fn4 on RCSB PDB site
Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
Deposited on 2000-08-21, released 2001-09-26
The last revision prior to the SCOP 1.65 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4A (A:)
    dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
    rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkrtaptvsifppste
    qlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsltk
    adyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4B (B:)
    qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
    salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
    vssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsglytl
    tssvtvpsstwssqavtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4C (C:)
    dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
    rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkrtaptvsifppste
    qlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsltk
    adyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fn4D (D:)
    qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
    salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
    vssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsglytl
    tssvtvpsstwssqavtcnvahpasstkvdkkivprdc