PDB entry 1fmz

View 1fmz on RCSB PDB site
Description: crystal structure of a mutant winged bean chymotrypsin inhibitor protein, n14k.
Class: hydrolase inhibitor
Keywords: Beta Trefoil, HYDROLASE INHIBITOR
Deposited on 2000-08-19, released 2001-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin inhibitor 3
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10822 (3-End)
      • cloning artifact (1-2)
      • engineered (16)
    Domains in SCOPe 2.06: d1fmza1, d1fmza2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmzA (A:)
    mefdddlvdaegnlvekggtyyllphiwahgggietaktgnepcpltvvrspnevskgep
    irissqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvf
    kfekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks
    etassh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmzA (A:)
    efdddlvdaegnlvekggtyyllphiwahgggietaktgnepcpltvvrspnevskgepi
    rissqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfk
    fekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks