PDB entry 1fmx

View 1fmx on RCSB PDB site
Description: structure of native proteinase a in the space group p21
Class: hydrolase
Keywords: proteinase A, HYDROLASE
Deposited on 2000-08-18, released 2002-07-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: saccharopepsin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fmxa_
  • Chain 'B':
    Compound: saccharopepsin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fmxb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmxA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmxA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqylegyisqdtlsigdltipkqdfaeatsepgltfafgkfdgilgl
    gydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfkgdit
    wlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeigakkgw
    tgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgplaiv
    gdaflrkyysiydlgnnavglakai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fmxB (B:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmxB (B:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqylegyisqdtlsigdltipkqdfaeatsepgltfafgkfdgilgl
    gydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfkgdit
    wlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeigakkgw
    tgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgplaiv
    gdaflrkyysiydlgnnavglakai