PDB entry 1fmw

View 1fmw on RCSB PDB site
Description: crystal structure of the mgatp complex for the motor domain of dictyostelium myosin II
Class: contractile protein
Keywords: myosin motor domaim
Deposited on 2000-08-18, released 2000-11-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-758)
      • conflict (311)
      • conflict (488)
    Domains in SCOP 1.75: d1fmwa1, d1fmwa2
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmwA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearepn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmwA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrgvleqqilqanpileafgnakttrnnnssrfgkfieiqf
    nnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnyl
    nqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagega
    vlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalyg
    rlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmf
    kveqeeylkekidsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskkna
    kyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfndpn
    iasrafitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcngv
    legiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlnidpeqyrfgi
    tkiffragqlarieeare