PDB entry 1fmv

View 1fmv on RCSB PDB site
Description:
Deposited on 2000-08-18, released 2000-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fmva1, d1fmva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmvA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfgk
    fieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagp
    esfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfek
    gagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdal
    vkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqf
    fnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdn
    tlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfk
    dssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnk
    qlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqk
    atdavlkhlnidpeqyrfgitkiffragqlarieeare
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmvA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrgvleqqilqanpileafgnakttrnnnssrfgkfieiqf
    nnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnyl
    nqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagega
    vlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalyg
    rlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmf
    kveqeeylkekinwgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfs
    kknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklf
    ndpniasranfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldql
    rcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlnidpeq
    yrfgitkiffragqlarieeare