PDB entry 1fmv

View 1fmv on RCSB PDB site
Description: crystal structure of the apo motor domain of dictyostellium myosin II
Class: contractile protein
Keywords: myosin motor domain, CONTRACTILE PROTEIN
Deposited on 2000-08-18, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-758)
      • conflict (311)
      • conflict (488)
    Domains in SCOPe 2.07: d1fmva1, d1fmva2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmvA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearepn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmvA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrgvleqqilqanpileafgnakttrnnnssrfgkfieiqf
    nnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnyl
    nqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagega
    vlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalyg
    rlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmf
    kveqeeylkekinwgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfs
    kknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklf
    ndpniasranfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldql
    rcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlnidpeq
    yrfgitkiffragqlarieeare