PDB entry 1fmu

View 1fmu on RCSB PDB site
Description: structure of native proteinase a in p3221 space group.
Class: hydrolase
Keywords: Proteinase A, HYDROLASE
Deposited on 2000-08-18, released 2002-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: saccharopepsin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fmua_
  • Heterogens: MAN, NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmuA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmuA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdgeatfggideskfkgdit
    wlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeigakkgq
    ytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgplaivgda
    flrkyysiydlgnnavglakai