PDB entry 1fmm

View 1fmm on RCSB PDB site
Description: solution structure of nfgf-1
Class: hormone/growth factor
Keywords: growth factor, triple resonance, mitogen, wound healing, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2000-08-18, released 2001-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: acidic fibroblast growth factor
    Species: Notophthalmus viridescens [TaxId:8316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1fmms_

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fmmS (S:)
    qkpkllycsnggyflrifpdgkvdgtrdrsdpyiqlqfyaesvgevyiksletgqylamd
    sdgqlyasqspseeclflerleennyntykskvhadkdwfvgikkngktkpgsrthfgqk
    ailflplpvssd