PDB entry 1fmi

View 1fmi on RCSB PDB site
Description: crystal structure of human class I alpha1,2-mannosidase
Class: hydrolase
Keywords: alpha-alpha7 barrel, HYDROLASE
Deposited on 2000-08-17, released 2001-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum alpha-mannosidase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKM7 (3-457)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1fmia1, d1fmia2
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmiA (A:)
    aqgpvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmw
    ilglrkefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfg
    nrlmpafrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqe
    avekvtqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkq
    etqlledyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyh
    glpashmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpe
    tveslfylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesf
    flgetlkylfllfsddpnllsldayvfnteahplpiwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmiA (A:)
    aqgpvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmw
    ilglrkefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfg
    nrlmpafrtpskipysdvnigtgvahpprsdstvaevtsiqlefrelsrltgdkkfqeav
    ekvtqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqet
    qlledyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhgl
    pashmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetv
    eslfylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesffl
    getlkylfllfsddpnllsldayvfnteahplpiwt