PDB entry 1fmg

View 1fmg on RCSB PDB site
Description: crystal structure of porcine beta trypsin with 0.04% polydocanol
Class: hydrolase
Keywords: serine protease, hydrolase
Deposited on 2000-08-17, released 2000-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • see remark 999 (144)
      • see remark 999 (166)
    Domains in SCOP 1.73: d1fmga_
  • Heterogens: CA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fmgA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan