PDB entry 1fmf

View 1fmf on RCSB PDB site
Description: refined solution structure of the (13c,15n-labeled) b12-binding subunit of glutamate mutase from clostridium tetanomorphum
Class: isomerase
Keywords: nucleotide binding fold, Rossmann fold, ISOMERASE
Deposited on 2000-08-17, released 2002-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methylaspartate mutase s chain
  Species: Clostridium tetanomorphum [TaxId:1553]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05488 (0-136)
  Domains in SCOPe 2.08: d1fmfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fmfA (A:)
  mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
  sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
  tspettiadmkevlgve