PDB entry 1fmb

View 1fmb on RCSB PDB site
Description: eiav protease complexed with the inhibitor hby-793
Deposited on 1996-02-27, released 1996-10-14
The last revision prior to the SCOP 1.59 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.136
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1fmb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fmb_ (-)
  vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
  etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl