PDB entry 1fm9

View 1fm9 on RCSB PDB site
Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and gi262570 and co-activator peptides.
Class: transcription
Keywords: the heterodimer of the nuclear receptor ligand binding domains of RXRalpha and PPARgamma bound respectively with 9-cis Retinoic Acid and GI262570 and co-activator peptides, TRANSCRIPTION
Deposited on 2000-08-16, released 2001-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fm9a_
  • Chain 'B':
    Compound: steroid receptor coactivator
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fm9d_
  • Chain 'E':
    Compound: steroid receptor coactivator
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 9CR, 570, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fm9A (A:)
    sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fm9A (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm9D (D:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'E':
    No sequence available.