PDB entry 1fm4

View 1fm4 on RCSB PDB site
Description: crystal structure of the birch pollen allergen bet v 1l
Class: allergen
Keywords: alpha-beta: 6 anti-parallel beta strands and 3 alpha helices., ALLERGEN
Deposited on 2000-08-16, released 2002-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-l
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fm4a_
  • Heterogens: DXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm4A (A:)
    gvfnyeteatsvipaarmfkafildgdklvpkvapqaissveniegnggpgtikkinfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnky
    htkgnhevkaeqvkaskemgetllravesyllahsdayn