PDB entry 1flz

View 1flz on RCSB PDB site
Description: uracil DNA glycosylase with uaap
Class: hydrolase
Keywords: glycosylase, hydrolase
Deposited on 2000-08-15, released 2001-01-17
The last revision prior to the SCOP 1.75 freeze date was dated 2001-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12295 (0-227)
      • engineered (17)
      • mutation (211)
    Domains in SCOP 1.75: d1flza_
  • Heterogens: URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flzA (A:)
    aneltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese